Rab7Protein[10167][100µg]CatalogNumber:10167ProductName:Rab7ProteinSynonyms:MemberRASoncogenefamily,Rab7a,MGC102153Source:Human,recombinantfulllength,His6-tagExpressionHost:E

詳細介紹

Rab7 Protein [10167]
[100 µg]

Catalog Number: 10167

Product Name: Rab7 Protein

Synonyms: Member RAS oncogene family, Rab7a, MGC102153

Source: Human, recombinant full length, His6-tag

Expression Host: E. coli

Molecular Weight: 23 kDa

Purity: >95% by SDS-PAGE

Introduction: Members of the Rab family of Ras-related GTP-binding proteins are important regulators of vesicular transport and are located in specific intracellular compartments. Rab7 has been localized to late endosomes and shown to be important in the late endocytic pathway. In addition, it has been shown to have a fundamental role in the cellular vacuolation induced by the cytotoxin VacA of Helicobacter pylori.

Amino Acid Sequence (1-207)

MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQ
ERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRQV
ATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEVELYNEFPEPIKLDKNDRAKASAESCSC

Properties

Physical Appearance (form): Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl.

Physical Appearance (form): White or clear

Concentration: 1 mg/mL

Storage: -80°C

Preparation Instructions:
Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged Rab7 was determined by SDS- PAGE and Coomassie Brilliant Blue Staining.

References:
1. Edinger, A. L. et al., Dev. Cell 5: 571-582, 2003. 2. Houlden, H. et al., Ann. Neurol. 56: 586-590, 2004.
3. Meggouh, F. et al., Neurology 67: 1476-1478, 2006.
4. Rak, A. et al., Cell 117: 749-760, 2004.
5. Verhoeven, K. et al., Am. J. Hum. Genet. 72: 722-727, 2003.

Datasheet:

Related Products
Catalog#	Name	Size	Price
	Rab7 Activation Assay Kit	20 assays	￥6800
	Active Rab7-GTP Monoclonal Antibody	30 μL	￥4800
	Anti-Rab7A Rabbit Polyclonal Antibody	100 μL	￥2600